Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 5 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,826
  2. Avatar for Go Science 2. Go Science 71 pts. 11,778
  3. Avatar for VeFold 3. VeFold 49 pts. 11,742
  4. Avatar for Contenders 4. Contenders 33 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 11,683
  6. Avatar for Australia 6. Australia 14 pts. 11,639
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 8 pts. 11,625
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,543
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 11,471
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,460

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 24 pts. 11,625
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 22 pts. 11,621
  3. Avatar for Elfi 23. Elfi Lv 1 20 pts. 11,620
  4. Avatar for westchuck 24. westchuck Lv 1 18 pts. 11,607
  5. Avatar for g_b 25. g_b Lv 1 17 pts. 11,603
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 15 pts. 11,583
  7. Avatar for zxspectrum 27. zxspectrum Lv 1 14 pts. 11,569
  8. Avatar for ichwilldiesennamen 28. ichwilldiesennamen Lv 1 13 pts. 11,563
  9. Avatar for AlphaFold2 29. AlphaFold2 Lv 1 12 pts. 11,560
  10. Avatar for TheGUmmer 30. TheGUmmer Lv 1 11 pts. 11,543

Comments