Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 11,333
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 11,188
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,861
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,846
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 10,807
  6. Avatar for Team China 16. Team China 1 pt. 10,785
  1. Avatar for majyunyan 31. majyunyan Lv 1 10 pts. 11,530
  2. Avatar for Fasodankfds 32. Fasodankfds Lv 1 9 pts. 11,527
  3. Avatar for silent gene 33. silent gene Lv 1 8 pts. 11,521
  4. Avatar for jtrube1 34. jtrube1 Lv 1 7 pts. 11,501
  5. Avatar for Joanna_H 35. Joanna_H Lv 1 6 pts. 11,471
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 6 pts. 11,469
  7. Avatar for jausmh 37. jausmh Lv 1 5 pts. 11,460
  8. Avatar for latin krepin 38. latin krepin Lv 1 5 pts. 11,438
  9. Avatar for SemperRabbit 39. SemperRabbit Lv 1 4 pts. 11,382
  10. Avatar for carsonfb 40. carsonfb Lv 1 4 pts. 11,381

Comments