Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 11,333
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 11,188
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,861
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,846
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 10,807
  6. Avatar for Team China 16. Team China 1 pt. 10,785
  1. Avatar for sato 71. sato Lv 1 1 pt. 10,796
  2. Avatar for Swapper242 72. Swapper242 Lv 1 1 pt. 10,789
  3. Avatar for zo3xiaJonWeinberg 73. zo3xiaJonWeinberg Lv 1 1 pt. 10,785
  4. Avatar for Matrena 74. Matrena Lv 1 1 pt. 10,776
  5. Avatar for Hellcat6 75. Hellcat6 Lv 1 1 pt. 10,627
  6. Avatar for DipsyDoodle2016 76. DipsyDoodle2016 Lv 1 1 pt. 9,985
  7. Avatar for salbei 77. salbei Lv 1 1 pt. 9,873
  8. Avatar for kushiro189 78. kushiro189 Lv 1 1 pt. 7,757
  9. Avatar for HNOF 79. HNOF Lv 1 1 pt. 7,742
  10. Avatar for toshiue 80. toshiue Lv 1 1 pt. 7,731

Comments