Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,241
  2. Avatar for Void Crushers 2. Void Crushers 78 pts. 10,232
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,209
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,205
  5. Avatar for Go Science 5. Go Science 33 pts. 10,197
  6. Avatar for Contenders 6. Contenders 24 pts. 10,141
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 10,124
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 10,097
  9. Avatar for Deleted group 9. Deleted group pts. 10,066
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 10,022
  1. Avatar for Psych0Active 91. Psych0Active Lv 1 13 pts. 9,676
  2. Avatar for Mydogisa Toelicker 92. Mydogisa Toelicker Lv 1 13 pts. 9,659
  3. Avatar for pfirth 93. pfirth Lv 1 12 pts. 9,649
  4. Avatar for dbuske 94. dbuske Lv 1 12 pts. 9,649
  5. Avatar for gurch 95. gurch Lv 1 12 pts. 9,646
  6. Avatar for NameChangeNeeded01 96. NameChangeNeeded01 Lv 1 11 pts. 9,642
  7. Avatar for froggs554 97. froggs554 Lv 1 11 pts. 9,636
  8. Avatar for Festering Wounds 98. Festering Wounds Lv 1 11 pts. 9,580
  9. Avatar for cobaltteal 99. cobaltteal Lv 1 11 pts. 9,567
  10. Avatar for Jim Fraser 100. Jim Fraser Lv 1 10 pts. 9,548

Comments