Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,241
  2. Avatar for Void Crushers 2. Void Crushers 78 pts. 10,232
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,209
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,205
  5. Avatar for Go Science 5. Go Science 33 pts. 10,197
  6. Avatar for Contenders 6. Contenders 24 pts. 10,141
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 10,124
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 10,097
  9. Avatar for Deleted group 9. Deleted group pts. 10,066
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 10,022

  1. Avatar for mitarcher 111. mitarcher Lv 1 7 pts. 9,356
  2. Avatar for lamoille 112. lamoille Lv 1 7 pts. 9,314
  3. Avatar for fpc 113. fpc Lv 1 7 pts. 9,269
  4. Avatar for petetrig 114. petetrig Lv 1 7 pts. 9,240
  5. Avatar for SouperGenious 115. SouperGenious Lv 1 7 pts. 9,238
  6. Avatar for rezaefar 116. rezaefar Lv 1 6 pts. 9,194
  7. Avatar for Mr_Jolty 117. Mr_Jolty Lv 1 6 pts. 9,193
  8. Avatar for arginia 118. arginia Lv 1 6 pts. 9,192
  9. Avatar for Vinara 119. Vinara Lv 1 6 pts. 9,162
  10. Avatar for harvardman 120. harvardman Lv 1 6 pts. 9,161

Comments