Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702
  1. Avatar for jamiexq 111. jamiexq Lv 1 3 pts. 8,073
  2. Avatar for Petrifolder 112. Petrifolder Lv 1 2 pts. 8,053
  3. Avatar for uihcv 113. uihcv Lv 1 2 pts. 8,034
  4. Avatar for tela 114. tela Lv 1 2 pts. 8,021
  5. Avatar for birdman85_01 115. birdman85_01 Lv 1 2 pts. 8,008
  6. Avatar for momadoc 116. momadoc Lv 1 2 pts. 7,973
  7. Avatar for Merf 117. Merf Lv 1 2 pts. 7,952
  8. Avatar for Cerzax 118. Cerzax Lv 1 2 pts. 7,912
  9. Avatar for stomjoh 119. stomjoh Lv 1 2 pts. 7,910
  10. Avatar for parsnip 120. parsnip Lv 1 2 pts. 7,893

Comments