Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702
  1. Avatar for abiogenesis 131. abiogenesis Lv 1 1 pt. 7,427
  2. Avatar for dahast.de 132. dahast.de Lv 1 1 pt. 7,398
  3. Avatar for mondetta77 133. mondetta77 Lv 1 1 pt. 7,386
  4. Avatar for justjustin 134. justjustin Lv 1 1 pt. 7,354
  5. Avatar for 01010011111 135. 01010011111 Lv 1 1 pt. 7,302
  6. Avatar for bwkittitas 136. bwkittitas Lv 1 1 pt. 7,217
  7. Avatar for Redoir 137. Redoir Lv 1 1 pt. 7,190
  8. Avatar for Tac1 138. Tac1 Lv 1 1 pt. 7,108
  9. Avatar for FreeFolder 139. FreeFolder Lv 1 1 pt. 7,073
  10. Avatar for jjb7371 140. jjb7371 Lv 1 1 pt. 6,972

Comments