Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups


  1. Avatar for Contenders 100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702

  1. Avatar for WBarme1234 91. WBarme1234 Lv 1 6 pts. 8,415
  2. Avatar for cbwest 92. cbwest Lv 1 6 pts. 8,402
  3. Avatar for Origami314 93. Origami314 Lv 1 5 pts. 8,379
  4. Avatar for BCAA 94. BCAA Lv 1 5 pts. 8,373
  5. Avatar for t012 95. t012 Lv 1 5 pts. 8,337
  6. Avatar for Punktchen 96. Punktchen Lv 1 5 pts. 8,293
  7. Avatar for altejoh 97. altejoh Lv 1 5 pts. 8,227
  8. Avatar for dbuske 98. dbuske Lv 1 4 pts. 8,217
  9. Avatar for mitarcher 99. mitarcher Lv 1 4 pts. 8,194
  10. Avatar for Amphimixus 100. Amphimixus Lv 1 4 pts. 8,191

Comments