Placeholder image of a protein
Icon representing a puzzle

1231: Unsolved De-novo Freestyle 79

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 10, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MDAPASFSLGAMGPLLRKLDSLLVAPEIRLPKPLKEGIELLKEDLEEIGVSLVEHSVVDSPTHKARFWMDEVRDLSYHIEDCIDTMFSMRSGGDDGKPRSERRHKVGRAKIDGFSKKPKPCTRMARIAELRALVREASERLERYQLGDVCGSSS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,764
  3. Avatar for Go Science 3. Go Science 56 pts. 9,720
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,701
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,642
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,584
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 9,398
  8. Avatar for Deleted group 8. Deleted group pts. 9,360
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,021
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,702
  1. Avatar for joremen 71. joremen Lv 1 13 pts. 8,802
  2. Avatar for isaksson 72. isaksson Lv 1 12 pts. 8,775
  3. Avatar for phi16 73. phi16 Lv 1 12 pts. 8,740
  4. Avatar for kitek314_pl 74. kitek314_pl Lv 1 11 pts. 8,702
  5. Avatar for diamonddays 75. diamonddays Lv 1 11 pts. 8,697
  6. Avatar for TastyMunchies 76. TastyMunchies Lv 1 11 pts. 8,661
  7. Avatar for Deleted player 77. Deleted player pts. 8,656
  8. Avatar for pfirth 78. pfirth Lv 1 10 pts. 8,605
  9. Avatar for guineapig 79. guineapig Lv 1 9 pts. 8,601
  10. Avatar for boondog 80. boondog Lv 1 9 pts. 8,595

Comments