Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,731
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,716
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,682
  4. Avatar for Contenders 4. Contenders 36 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,550
  6. Avatar for Go Science 6. Go Science 16 pts. 9,464
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,460
  8. Avatar for Deleted group 8. Deleted group pts. 9,304
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,298
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,806
  1. Avatar for Bruno Kestemont 31. Bruno Kestemont Lv 1 43 pts. 9,400
  2. Avatar for jermainiac 32. jermainiac Lv 1 42 pts. 9,393
  3. Avatar for g_b 33. g_b Lv 1 41 pts. 9,393
  4. Avatar for johnmitch 34. johnmitch Lv 1 40 pts. 9,387
  5. Avatar for Glen B 35. Glen B Lv 1 38 pts. 9,386
  6. Avatar for alwen 36. alwen Lv 1 37 pts. 9,382
  7. Avatar for pauldunn 37. pauldunn Lv 1 36 pts. 9,379
  8. Avatar for alcor29 38. alcor29 Lv 1 35 pts. 9,377
  9. Avatar for pvc78 39. pvc78 Lv 1 34 pts. 9,372
  10. Avatar for kabubi 40. kabubi Lv 1 33 pts. 9,356

Comments