Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,731
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,716
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,682
  4. Avatar for Contenders 4. Contenders 36 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,550
  6. Avatar for Go Science 6. Go Science 16 pts. 9,464
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,460
  8. Avatar for Deleted group 8. Deleted group pts. 9,304
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,298
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,806
  1. Avatar for Steven Pletsch 41. Steven Pletsch Lv 1 32 pts. 9,304
  2. Avatar for O Seki To 42. O Seki To Lv 1 31 pts. 9,298
  3. Avatar for jobo0502 43. jobo0502 Lv 1 30 pts. 9,291
  4. Avatar for nicobul 44. nicobul Lv 1 29 pts. 9,287
  5. Avatar for WBarme1234 45. WBarme1234 Lv 1 28 pts. 9,268
  6. Avatar for stomjoh 46. stomjoh Lv 1 27 pts. 9,262
  7. Avatar for pmdpmd 47. pmdpmd Lv 1 26 pts. 9,244
  8. Avatar for TastyMunchies 48. TastyMunchies Lv 1 25 pts. 9,234
  9. Avatar for heather-1 49. heather-1 Lv 1 24 pts. 9,229
  10. Avatar for jamiexq 50. jamiexq Lv 1 24 pts. 9,223

Comments