Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,731
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,716
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,682
  4. Avatar for Contenders 4. Contenders 36 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,550
  6. Avatar for Go Science 6. Go Science 16 pts. 9,464
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,460
  8. Avatar for Deleted group 8. Deleted group pts. 9,304
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,298
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,806

  1. Avatar for MicElephant 71. MicElephant Lv 1 11 pts. 8,998
  2. Avatar for JayD7217 72. JayD7217 Lv 1 11 pts. 8,931
  3. Avatar for Jesse Pinkman 73. Jesse Pinkman Lv 1 10 pts. 8,910
  4. Avatar for Deleted player 74. Deleted player pts. 8,892
  5. Avatar for bzipitidoo 75. bzipitidoo Lv 1 9 pts. 8,886
  6. Avatar for Superphosphate 76. Superphosphate Lv 1 9 pts. 8,879
  7. Avatar for georg137 77. georg137 Lv 1 9 pts. 8,862
  8. Avatar for tallguy-13088 78. tallguy-13088 Lv 1 8 pts. 8,857
  9. Avatar for SKSbell 79. SKSbell Lv 1 8 pts. 8,852
  10. Avatar for uihcv 80. uihcv Lv 1 8 pts. 8,847

Comments