Placeholder image of a protein
Icon representing a puzzle

1283: Unsolved De-novo Freestyle 86

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
September 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RLDELEELKKELEKDRERWEKQTTSSHLEELKKELEKLKKELEKMKGDQTEHRFRTRYRTDTSEYEVEIEITDGQTRMRSREHSR

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,731
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,716
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,682
  4. Avatar for Contenders 4. Contenders 36 pts. 9,640
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 9,550
  6. Avatar for Go Science 6. Go Science 16 pts. 9,464
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,460
  8. Avatar for Deleted group 8. Deleted group pts. 9,304
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,298
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,806
  1. Avatar for Blipperman 61. Blipperman Lv 1 16 pts. 9,076
  2. Avatar for ManVsYard 62. ManVsYard Lv 1 15 pts. 9,075
  3. Avatar for weitzen 63. weitzen Lv 1 15 pts. 9,075
  4. Avatar for caglar 64. caglar Lv 1 14 pts. 9,037
  5. Avatar for YeshuaLives 65. YeshuaLives Lv 1 14 pts. 9,028
  6. Avatar for RestrictionEndoNykolease 66. RestrictionEndoNykolease Lv 1 13 pts. 9,022
  7. Avatar for peterstumpf 67. peterstumpf Lv 1 13 pts. 9,013
  8. Avatar for randomlil 68. randomlil Lv 1 12 pts. 9,010
  9. Avatar for Anfinsen_slept_here 69. Anfinsen_slept_here Lv 1 12 pts. 9,009
  10. Avatar for dbuske 70. dbuske Lv 1 11 pts. 9,003

Comments