Placeholder image of a protein
Icon representing a puzzle

1307: Unsolved De-novo Freestyle 90

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QEKMERIRQRFEEDLKKDNNMEVHIHLHNNKIELRIRIGNEESRVEVRINGDELDIQVRNSGKTIEELIQRWKEEIKKIV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,530
  2. Avatar for Go Science 2. Go Science 73 pts. 9,517
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,495
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 9,494
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,468
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,453
  7. Avatar for Deleted group 7. Deleted group pts. 9,448
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,396
  9. Avatar for xkcd 9. xkcd 4 pts. 9,287
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 8,464
  1. Avatar for isaksson 71. isaksson Lv 1 10 pts. 8,980
  2. Avatar for cjkunze1 72. cjkunze1 Lv 1 9 pts. 8,968
  3. Avatar for uihcv 73. uihcv Lv 1 9 pts. 8,938
  4. Avatar for ViJay7019 74. ViJay7019 Lv 1 8 pts. 8,907
  5. Avatar for saksoft2 75. saksoft2 Lv 1 8 pts. 8,879
  6. Avatar for manu8170 76. manu8170 Lv 1 8 pts. 8,848
  7. Avatar for drumpeter18yrs9yrs 77. drumpeter18yrs9yrs Lv 1 7 pts. 8,827
  8. Avatar for Norrjane 78. Norrjane Lv 1 7 pts. 8,811
  9. Avatar for monkry 79. monkry Lv 1 7 pts. 8,804
  10. Avatar for joremen 80. joremen Lv 1 7 pts. 8,783

Comments