Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,841
  2. Avatar for Go Science 2. Go Science 80 pts. 9,841
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,831
  4. Avatar for Contenders 4. Contenders 49 pts. 9,784
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,688
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,610
  7. Avatar for xkcd 7. xkcd 21 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,484
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,385
  10. Avatar for Kotocycle 10. Kotocycle 8 pts. 9,248
  1. Avatar for actiasluna 61. actiasluna Lv 1 16 pts. 9,269
  2. Avatar for Ikuso 62. Ikuso Lv 1 15 pts. 9,248
  3. Avatar for toshiue 63. toshiue Lv 1 15 pts. 9,225
  4. Avatar for drumpeter18yrs9yrs 64. drumpeter18yrs9yrs Lv 1 14 pts. 9,214
  5. Avatar for YeshuaLives 65. YeshuaLives Lv 1 14 pts. 9,166
  6. Avatar for stomjoh 66. stomjoh Lv 1 13 pts. 9,165
  7. Avatar for WBarme1234 67. WBarme1234 Lv 1 13 pts. 9,160
  8. Avatar for Deleted player 68. Deleted player pts. 9,155
  9. Avatar for YGK 69. YGK Lv 1 12 pts. 9,150
  10. Avatar for phi16 70. phi16 Lv 1 11 pts. 9,129

Comments