Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,841
  2. Avatar for Go Science 2. Go Science 80 pts. 9,841
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,831
  4. Avatar for Contenders 4. Contenders 49 pts. 9,784
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,688
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,610
  7. Avatar for xkcd 7. xkcd 21 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,484
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,385
  10. Avatar for Kotocycle 10. Kotocycle 8 pts. 9,248
  1. Avatar for Formula350 71. Formula350 Lv 1 11 pts. 9,113
  2. Avatar for SaraL 72. SaraL Lv 1 11 pts. 9,109
  3. Avatar for darioarena 73. darioarena Lv 1 10 pts. 9,104
  4. Avatar for Deleted player 74. Deleted player pts. 9,076
  5. Avatar for randomlil 75. randomlil Lv 1 9 pts. 9,069
  6. Avatar for georg137 76. georg137 Lv 1 9 pts. 9,067
  7. Avatar for katling 77. katling Lv 1 9 pts. 9,065
  8. Avatar for pfirth 78. pfirth Lv 1 8 pts. 9,061
  9. Avatar for SKSbell 79. SKSbell Lv 1 8 pts. 9,058
  10. Avatar for joremen 80. joremen Lv 1 8 pts. 8,985

Comments