Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,758
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,732
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,731
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,721
  5. Avatar for Contenders 5. Contenders 27 pts. 9,678
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,468
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,464
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,365
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,338
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,223
  1. Avatar for Bletchley Park 51. Bletchley Park Lv 1 15 pts. 9,292
  2. Avatar for crpainter 52. crpainter Lv 1 15 pts. 9,286
  3. Avatar for randomlil 53. randomlil Lv 1 14 pts. 9,282
  4. Avatar for fishercat 54. fishercat Lv 1 13 pts. 9,275
  5. Avatar for Deleted player 55. Deleted player pts. 9,274
  6. Avatar for guineapig 56. guineapig Lv 1 12 pts. 9,260
  7. Avatar for katling 57. katling Lv 1 12 pts. 9,249
  8. Avatar for tarimo 58. tarimo Lv 1 11 pts. 9,244
  9. Avatar for manu8170 59. manu8170 Lv 1 11 pts. 9,237
  10. Avatar for firejuggler 60. firejuggler Lv 1 10 pts. 9,237

Comments