Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209
  1. Avatar for frood66 11. frood66 Lv 1 71 pts. 9,371
  2. Avatar for gmn 12. gmn Lv 1 69 pts. 9,368
  3. Avatar for bertro 13. bertro Lv 1 66 pts. 9,362
  4. Avatar for grogar7 14. grogar7 Lv 1 64 pts. 9,356
  5. Avatar for anthion 15. anthion Lv 1 62 pts. 9,352
  6. Avatar for O Seki To 16. O Seki To Lv 1 59 pts. 9,351
  7. Avatar for Bruno Kestemont 17. Bruno Kestemont Lv 1 57 pts. 9,349
  8. Avatar for LociOiling 18. LociOiling Lv 1 55 pts. 9,334
  9. Avatar for gitwut 19. gitwut Lv 1 53 pts. 9,331
  10. Avatar for randomlil 20. randomlil Lv 1 51 pts. 9,327

Comments