Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Beta Folders 100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209

  1. Avatar for johnmitch 31. johnmitch Lv 1 33 pts. 9,257
  2. Avatar for altejoh 32. altejoh Lv 1 32 pts. 9,256
  3. Avatar for reefyrob 33. reefyrob Lv 1 30 pts. 9,242
  4. Avatar for hansvandenhof 34. hansvandenhof Lv 1 29 pts. 9,241
  5. Avatar for dssb 35. dssb Lv 1 28 pts. 9,233
  6. Avatar for Deleted player 36. Deleted player pts. 9,229
  7. Avatar for georg137 37. georg137 Lv 1 26 pts. 9,224
  8. Avatar for MicElephant 38. MicElephant Lv 1 24 pts. 9,219
  9. Avatar for Vincenzo Brancaccio 39. Vincenzo Brancaccio Lv 1 23 pts. 9,216
  10. Avatar for andrewxc 40. andrewxc Lv 1 22 pts. 9,212

Comments