Placeholder image of a protein
Icon representing a puzzle

1397: Revisiting Puzzle 124: PDZ Domain

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 29, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 9,437
  3. Avatar for Contenders 3. Contenders 56 pts. 9,413
  4. Avatar for Gargleblasters 4. Gargleblasters 41 pts. 9,409
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 9,394
  6. Avatar for Go Science 6. Go Science 20 pts. 9,390
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,371
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,351
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 9,302
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 9,209
  1. Avatar for mimi 21. mimi Lv 1 49 pts. 9,324
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 47 pts. 9,315
  3. Avatar for smilingone 23. smilingone Lv 1 45 pts. 9,315
  4. Avatar for kabubi 24. kabubi Lv 1 44 pts. 9,314
  5. Avatar for nicobul 25. nicobul Lv 1 42 pts. 9,302
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 40 pts. 9,298
  7. Avatar for caglar 27. caglar Lv 1 39 pts. 9,283
  8. Avatar for joremen 28. joremen Lv 1 37 pts. 9,278
  9. Avatar for christioanchauvin 29. christioanchauvin Lv 1 36 pts. 9,275
  10. Avatar for jobo0502 30. jobo0502 Lv 1 34 pts. 9,265

Comments