Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for pauldunn 31. pauldunn Lv 1 37 pts. 9,477
  2. Avatar for Bautho 32. Bautho Lv 1 36 pts. 9,471
  3. Avatar for YeshuaLives 33. YeshuaLives Lv 1 35 pts. 9,467
  4. Avatar for O Seki To 34. O Seki To Lv 1 33 pts. 9,461
  5. Avatar for Blipperman 35. Blipperman Lv 1 32 pts. 9,452
  6. Avatar for CanWeFoldItBetter 36. CanWeFoldItBetter Lv 1 31 pts. 9,445
  7. Avatar for Glen B 37. Glen B Lv 1 30 pts. 9,445
  8. Avatar for Anfinsen_slept_here 38. Anfinsen_slept_here Lv 1 29 pts. 9,444
  9. Avatar for jobo0502 39. jobo0502 Lv 1 28 pts. 9,411
  10. Avatar for SaraL 40. SaraL Lv 1 26 pts. 9,409

Comments