Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for pietro.willi 131. pietro.willi Lv 1 1 pt. 7,274
  2. Avatar for pandapharmd 132. pandapharmd Lv 1 1 pt. 7,272
  3. Avatar for Jspirit 133. Jspirit Lv 1 1 pt. 7,208
  4. Avatar for hwieczor 134. hwieczor Lv 1 1 pt. 7,206
  5. Avatar for Wyts 135. Wyts Lv 1 1 pt. 7,176
  6. Avatar for deathbat_87 136. deathbat_87 Lv 1 1 pt. 7,171
  7. Avatar for tshock1 137. tshock1 Lv 1 1 pt. 6,920
  8. Avatar for jdmclure 138. jdmclure Lv 1 1 pt. 6,687
  9. Avatar for DScott 139. DScott Lv 1 1 pt. 6,587
  10. Avatar for rob147147 140. rob147147 Lv 1 1 pt. 6,496

Comments