Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for Maerlyn138 51. Maerlyn138 Lv 1 17 pts. 9,250
  2. Avatar for heather-1 52. heather-1 Lv 1 16 pts. 9,223
  3. Avatar for dizzywings 53. dizzywings Lv 1 16 pts. 9,211
  4. Avatar for alwen 54. alwen Lv 1 15 pts. 9,174
  5. Avatar for weitzen 55. weitzen Lv 1 14 pts. 9,146
  6. Avatar for 181818 56. 181818 Lv 1 14 pts. 9,134
  7. Avatar for Altercomp 57. Altercomp Lv 1 13 pts. 9,121
  8. Avatar for johnmitch 58. johnmitch Lv 1 13 pts. 9,121
  9. Avatar for Flagg65a 59. Flagg65a Lv 1 12 pts. 9,119
  10. Avatar for fishercat 60. fishercat Lv 1 11 pts. 9,116

Comments