Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,795
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,790
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 9,790
  4. Avatar for Go Science 4. Go Science 38 pts. 9,774
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,772
  6. Avatar for Contenders 6. Contenders 18 pts. 9,768
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,743
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,735
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,696
  10. Avatar for Deleted group 10. Deleted group pts. 9,689
  1. Avatar for antibot215 121. antibot215 Lv 1 1 pt. 9,227
  2. Avatar for Savas 122. Savas Lv 1 1 pt. 9,227
  3. Avatar for Dijkgraaf 123. Dijkgraaf Lv 1 1 pt. 9,222
  4. Avatar for muhammedakd 124. muhammedakd Lv 1 1 pt. 9,185
  5. Avatar for Knoblerine 125. Knoblerine Lv 1 1 pt. 9,165
  6. Avatar for kyros95 126. kyros95 Lv 1 1 pt. 9,160
  7. Avatar for momadoc 127. momadoc Lv 1 1 pt. 9,157
  8. Avatar for aspadistra 128. aspadistra Lv 1 1 pt. 9,136
  9. Avatar for Wheeler22 129. Wheeler22 Lv 1 1 pt. 9,126
  10. Avatar for sendasticloop 130. sendasticloop Lv 1 1 pt. 9,112

Comments