Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,795
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,790
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 9,790
  4. Avatar for Go Science 4. Go Science 38 pts. 9,774
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,772
  6. Avatar for Contenders 6. Contenders 18 pts. 9,768
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,743
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,735
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,696
  10. Avatar for Deleted group 10. Deleted group pts. 9,689
  1. Avatar for RyanPersson 141. RyanPersson Lv 1 1 pt. 9,039
  2. Avatar for flemdogmillionaire 142. flemdogmillionaire Lv 1 1 pt. 8,948
  3. Avatar for R2 D2 143. R2 D2 Lv 1 1 pt. 8,947
  4. Avatar for dahast.de 144. dahast.de Lv 1 1 pt. 8,932
  5. Avatar for Vuski 145. Vuski Lv 1 1 pt. 8,858
  6. Avatar for wojto.htc 146. wojto.htc Lv 1 1 pt. 8,543
  7. Avatar for ozanertekin 147. ozanertekin Lv 1 1 pt. 8,514
  8. Avatar for west.elsdon 148. west.elsdon Lv 1 1 pt. 8,514
  9. Avatar for 01010011111 149. 01010011111 Lv 1 1 pt. 8,375
  10. Avatar for 4030_18_Enin 150. 4030_18_Enin Lv 1 1 pt. 8,348

Comments