Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,795
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,790
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 9,790
  4. Avatar for Go Science 4. Go Science 38 pts. 9,774
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,772
  6. Avatar for Contenders 6. Contenders 18 pts. 9,768
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,743
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,735
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,696
  10. Avatar for Deleted group 10. Deleted group pts. 9,689
  1. Avatar for eusair 21. eusair Lv 1 52 pts. 9,722
  2. Avatar for hpaege 22. hpaege Lv 1 51 pts. 9,722
  3. Avatar for Deleted player 23. Deleted player pts. 9,718
  4. Avatar for robgee 24. robgee Lv 1 47 pts. 9,712
  5. Avatar for toshiue 25. toshiue Lv 1 46 pts. 9,707
  6. Avatar for frood66 26. frood66 Lv 1 44 pts. 9,706
  7. Avatar for johnmitch 27. johnmitch Lv 1 42 pts. 9,705
  8. Avatar for georg137 28. georg137 Lv 1 41 pts. 9,702
  9. Avatar for Flagg65a 29. Flagg65a Lv 1 39 pts. 9,699
  10. Avatar for Deleted player 30. Deleted player pts. 9,698

Comments