Placeholder image of a protein
Icon representing a puzzle

1471: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 16, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,205
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 10,137
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,110
  4. Avatar for Go Science 4. Go Science 49 pts. 10,094
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 10,037
  6. Avatar for Contenders 6. Contenders 28 pts. 10,022
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,979
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,941
  9. Avatar for Marvin's bunch 9. Marvin's bunch 11 pts. 9,937
  10. Avatar for GENE 433 10. GENE 433 8 pts. 9,816

  1. Avatar for weitzen 41. weitzen Lv 1 25 pts. 9,886
  2. Avatar for YeshuaLives 42. YeshuaLives Lv 1 24 pts. 9,880
  3. Avatar for diamonddays 43. diamonddays Lv 1 23 pts. 9,879
  4. Avatar for jobo0502 44. jobo0502 Lv 1 22 pts. 9,877
  5. Avatar for fiendish_ghoul 45. fiendish_ghoul Lv 1 21 pts. 9,873
  6. Avatar for SKSbell 46. SKSbell Lv 1 20 pts. 9,873
  7. Avatar for SaraL 47. SaraL Lv 1 20 pts. 9,872
  8. Avatar for toshiue 48. toshiue Lv 1 19 pts. 9,869
  9. Avatar for Idiotboy 49. Idiotboy Lv 1 18 pts. 9,868
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 17 pts. 9,866

Comments