Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for andrewtmaxwell 71. andrewtmaxwell Lv 1 6 pts. 8,827
  2. Avatar for pfirth 72. pfirth Lv 1 6 pts. 8,765
  3. Avatar for Sissue 73. Sissue Lv 1 5 pts. 8,740
  4. Avatar for thewholeblahthing 74. thewholeblahthing Lv 1 5 pts. 8,723
  5. Avatar for Psych0Active 75. Psych0Active Lv 1 5 pts. 8,719
  6. Avatar for atlas100 76. atlas100 Lv 1 5 pts. 8,712
  7. Avatar for benrh 77. benrh Lv 1 4 pts. 8,701
  8. Avatar for SaraL 78. SaraL Lv 1 4 pts. 8,698
  9. Avatar for NotJim99 79. NotJim99 Lv 1 4 pts. 8,689
  10. Avatar for senor pit 80. senor pit Lv 1 4 pts. 8,685

Comments