Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for ManVsYard 81. ManVsYard Lv 1 3 pts. 8,681
  2. Avatar for Maerlyn138 82. Maerlyn138 Lv 1 3 pts. 8,673
  3. Avatar for @lison 83. @lison Lv 1 3 pts. 8,660
  4. Avatar for ViJay7019 84. ViJay7019 Lv 1 3 pts. 8,640
  5. Avatar for Knoblerine 85. Knoblerine Lv 1 3 pts. 8,629
  6. Avatar for rabamino12358 86. rabamino12358 Lv 1 3 pts. 8,623
  7. Avatar for georg137 87. georg137 Lv 1 2 pts. 8,620
  8. Avatar for SKSbell 88. SKSbell Lv 1 2 pts. 8,606
  9. Avatar for jausmh 89. jausmh Lv 1 2 pts. 8,590
  10. Avatar for sciencewalker 90. sciencewalker Lv 1 2 pts. 8,588

Comments