Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708

  1. Avatar for Puttering 131. Puttering Lv 1 1 pt. 5,458
  2. Avatar for drjr 133. drjr Lv 1 1 pt. 5,232
  3. Avatar for ghiggins 134. ghiggins Lv 1 1 pt. 5,184
  4. Avatar for may of rose 135. may of rose Lv 1 1 pt. 5,108
  5. Avatar for alyssajoyh 136. alyssajoyh Lv 1 1 pt. 5,072
  6. Avatar for DmitrySokolov 137. DmitrySokolov Lv 1 1 pt. 5,065
  7. Avatar for plouf 138. plouf Lv 1 1 pt. 5,064
  8. Avatar for hansvandenhof 139. hansvandenhof Lv 1 1 pt. 5,061
  9. Avatar for Norbika 140. Norbika Lv 1 1 pt. 5,060

Comments