Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708

  1. Avatar for strelokXxX 111. strelokXxX Lv 1 1 pt. 7,108
  2. Avatar for Bautho 112. Bautho Lv 1 1 pt. 7,026
  3. Avatar for FractalCuber 113. FractalCuber Lv 1 1 pt. 7,001
  4. Avatar for cocl2 114. cocl2 Lv 1 1 pt. 6,987
  5. Avatar for kingdiamonds 115. kingdiamonds Lv 1 1 pt. 6,970
  6. Avatar for gabrielcgs 116. gabrielcgs Lv 1 1 pt. 6,873
  7. Avatar for PaulusMa 117. PaulusMa Lv 1 1 pt. 6,849
  8. Avatar for Flagg65a 118. Flagg65a Lv 1 1 pt. 6,764
  9. Avatar for Gahmeir 119. Gahmeir Lv 1 1 pt. 6,457
  10. Avatar for edgar.montemayor 120. edgar.montemayor Lv 1 1 pt. 6,290

Comments