Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 1 pt. 6,239
  1. Avatar for bzipitidoo 91. bzipitidoo Lv 1 2 pts. 7,816
  2. Avatar for rinze 92. rinze Lv 1 2 pts. 7,804
  3. Avatar for lamoille 93. lamoille Lv 1 2 pts. 7,803
  4. Avatar for SKSbell 94. SKSbell Lv 1 1 pt. 7,763
  5. Avatar for TY2017 95. TY2017 Lv 1 1 pt. 7,710
  6. Avatar for micheldeweerd 96. micheldeweerd Lv 1 1 pt. 7,685
  7. Avatar for nellasdim 97. nellasdim Lv 1 1 pt. 7,667
  8. Avatar for Knoblerine 98. Knoblerine Lv 1 1 pt. 7,666
  9. Avatar for jausmh 99. jausmh Lv 1 1 pt. 7,657
  10. Avatar for dbuske 100. dbuske Lv 1 1 pt. 7,647

Comments