Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708

  1. Avatar for retiredmichael 11. retiredmichael Lv 1 72 pts. 9,205
  2. Avatar for frood66 12. frood66 Lv 1 69 pts. 9,191
  3. Avatar for bertro 13. bertro Lv 1 67 pts. 9,151
  4. Avatar for Deleted player 14. Deleted player pts. 9,149
  5. Avatar for eusair 15. eusair Lv 1 62 pts. 9,147
  6. Avatar for guineapig 16. guineapig Lv 1 60 pts. 9,142
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 58 pts. 9,125
  8. Avatar for Vinara 18. Vinara Lv 1 56 pts. 9,115
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 54 pts. 9,110
  10. Avatar for tarimo 20. tarimo Lv 1 52 pts. 9,098

Comments