Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 1 pt. 6,239
  1. Avatar for Enzyme 21. Enzyme Lv 1 50 pts. 9,079
  2. Avatar for pauldunn 22. pauldunn Lv 1 48 pts. 9,074
  3. Avatar for spvincent 23. spvincent Lv 1 47 pts. 9,032
  4. Avatar for Skippysk8s 24. Skippysk8s Lv 1 45 pts. 9,019
  5. Avatar for Blipperman 25. Blipperman Lv 1 43 pts. 8,994
  6. Avatar for smilingone 26. smilingone Lv 1 41 pts. 8,968
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 40 pts. 8,965
  8. Avatar for reefyrob 28. reefyrob Lv 1 38 pts. 8,962
  9. Avatar for manu8170 29. manu8170 Lv 1 37 pts. 8,939
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 35 pts. 8,916

Comments