Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708

  1. Avatar for dizzywings 31. dizzywings Lv 1 34 pts. 8,904
  2. Avatar for hpaege 32. hpaege Lv 1 33 pts. 8,884
  3. Avatar for pvc78 33. pvc78 Lv 1 31 pts. 8,878
  4. Avatar for DoctorSockrates 34. DoctorSockrates Lv 1 30 pts. 8,856
  5. Avatar for TastyMunchies 35. TastyMunchies Lv 1 29 pts. 8,848
  6. Avatar for Deleted player 36. Deleted player pts. 8,836
  7. Avatar for georg137 37. georg137 Lv 1 27 pts. 8,813
  8. Avatar for phi16 38. phi16 Lv 1 26 pts. 8,801
  9. Avatar for robgee 39. robgee Lv 1 24 pts. 8,788
  10. Avatar for isaksson 40. isaksson Lv 1 23 pts. 8,764

Comments