Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,865
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,848
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,820
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,778
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,706
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,703
  7. Avatar for Contenders 7. Contenders 8 pts. 9,636
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,613
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,587
  10. Avatar for DSN @ Home 10. DSN @ Home 2 pts. 9,181
  1. Avatar for Renthel 71. Renthel Lv 1 6 pts. 9,214
  2. Avatar for DoctorSockrates 72. DoctorSockrates Lv 1 6 pts. 9,213
  3. Avatar for rezaefar 73. rezaefar Lv 1 5 pts. 9,209
  4. Avatar for SKSbell 74. SKSbell Lv 1 5 pts. 9,202
  5. Avatar for aspadistra 75. aspadistra Lv 1 5 pts. 9,181
  6. Avatar for Amphimixus 76. Amphimixus Lv 1 5 pts. 9,173
  7. Avatar for leehaggis 77. leehaggis Lv 1 4 pts. 9,169
  8. Avatar for cobaltteal 78. cobaltteal Lv 1 4 pts. 9,161
  9. Avatar for hada 79. hada Lv 1 4 pts. 9,161
  10. Avatar for Sissue 80. Sissue Lv 1 4 pts. 9,156

Comments