Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023
  1. Avatar for sciencewalker 61. sciencewalker Lv 1 7 pts. 9,409
  2. Avatar for jausmh 62. jausmh Lv 1 6 pts. 9,404
  3. Avatar for heather-1 63. heather-1 Lv 1 6 pts. 9,378
  4. Avatar for alcor29 64. alcor29 Lv 1 6 pts. 9,355
  5. Avatar for TheGUmmer 65. TheGUmmer Lv 1 5 pts. 9,337
  6. Avatar for rezaefar 66. rezaefar Lv 1 5 pts. 9,336
  7. Avatar for DoctorSockrates 67. DoctorSockrates Lv 1 5 pts. 9,334
  8. Avatar for atlas100 68. atlas100 Lv 1 4 pts. 9,310
  9. Avatar for Kevin76 69. Kevin76 Lv 1 4 pts. 9,303
  10. Avatar for severin333 70. severin333 Lv 1 4 pts. 9,289

Comments