Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646
  1. Avatar for Pibeagles 121. Pibeagles Lv 1 1 pt. 10,685
  2. Avatar for larry25427 122. larry25427 Lv 1 1 pt. 10,647
  3. Avatar for bergie72 123. bergie72 Lv 1 1 pt. 10,644
  4. Avatar for drumpeter18yrs9yrs 124. drumpeter18yrs9yrs Lv 1 1 pt. 10,595
  5. Avatar for ingoneato 125. ingoneato Lv 1 1 pt. 10,571
  6. Avatar for Altair1191AC 126. Altair1191AC Lv 1 1 pt. 10,469
  7. Avatar for alpatios 127. alpatios Lv 1 1 pt. 10,372
  8. Avatar for coolsage999 128. coolsage999 Lv 1 1 pt. 10,345
  9. Avatar for Arne Heessels 129. Arne Heessels Lv 1 1 pt. 10,152
  10. Avatar for Matthew Hantsbarger 130. Matthew Hantsbarger Lv 1 1 pt. 10,134

Comments