Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646
  1. Avatar for ourtown 81. ourtown Lv 1 2 pts. 11,480
  2. Avatar for 181818 82. 181818 Lv 1 2 pts. 11,445
  3. Avatar for Deleted player 83. Deleted player pts. 11,444
  4. Avatar for hada 84. hada Lv 1 2 pts. 11,441
  5. Avatar for mitarcher 85. mitarcher Lv 1 2 pts. 11,416
  6. Avatar for froggs554 86. froggs554 Lv 1 1 pt. 11,389
  7. Avatar for flemdogmillionaire 87. flemdogmillionaire Lv 1 1 pt. 11,378
  8. Avatar for Nolan2E 88. Nolan2E Lv 1 1 pt. 11,368
  9. Avatar for atlas100 89. atlas100 Lv 1 1 pt. 11,365
  10. Avatar for rabamino12358 90. rabamino12358 Lv 1 1 pt. 11,356

Comments