Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646
  1. Avatar for wiegul 111. wiegul Lv 1 1 pt. 10,903
  2. Avatar for cjddig 112. cjddig Lv 1 1 pt. 10,868
  3. Avatar for Psych0Active 113. Psych0Active Lv 1 1 pt. 10,859
  4. Avatar for lamoille 114. lamoille Lv 1 1 pt. 10,837
  5. Avatar for gstelle 115. gstelle Lv 1 1 pt. 10,779
  6. Avatar for gokhanime 116. gokhanime Lv 1 1 pt. 10,765
  7. Avatar for TheGUmmer 117. TheGUmmer Lv 1 1 pt. 10,760
  8. Avatar for ghiggins 118. ghiggins Lv 1 1 pt. 10,731
  9. Avatar for krzycho7 119. krzycho7 Lv 1 1 pt. 10,729
  10. Avatar for aspadistra 120. aspadistra Lv 1 1 pt. 10,694

Comments