Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646

  1. Avatar for khendarg 101. khendarg Lv 1 1 pt. 11,164
  2. Avatar for silent gene 102. silent gene Lv 1 1 pt. 11,158
  3. Avatar for boondog 103. boondog Lv 1 1 pt. 11,138
  4. Avatar for Knoblerine 104. Knoblerine Lv 1 1 pt. 11,123
  5. Avatar for momadoc 105. momadoc Lv 1 1 pt. 11,113
  6. Avatar for hys08111 106. hys08111 Lv 1 1 pt. 11,061
  7. Avatar for wujikang 107. wujikang Lv 1 1 pt. 11,026
  8. Avatar for Noodle Soup 108. Noodle Soup Lv 1 1 pt. 11,006
  9. Avatar for JMStiffler 109. JMStiffler Lv 1 1 pt. 10,992
  10. Avatar for alyssa_d 110. alyssa_d Lv 1 1 pt. 10,921

Comments