Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646
  1. Avatar for Kevin76 71. Kevin76 Lv 1 4 pts. 11,646
  2. Avatar for Merf 72. Merf Lv 1 4 pts. 11,642
  3. Avatar for frostschutz 73. frostschutz Lv 1 3 pts. 11,586
  4. Avatar for fishercat 74. fishercat Lv 1 3 pts. 11,568
  5. Avatar for Superphosphate 75. Superphosphate Lv 1 3 pts. 11,567
  6. Avatar for jamiexq 76. jamiexq Lv 1 3 pts. 11,561
  7. Avatar for SaraL 77. SaraL Lv 1 3 pts. 11,534
  8. Avatar for ViJay7019 78. ViJay7019 Lv 1 2 pts. 11,523
  9. Avatar for johngran 79. johngran Lv 1 2 pts. 11,514
  10. Avatar for leehaggis 80. leehaggis Lv 1 2 pts. 11,508

Comments