Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for Vocaloid LB 131. Vocaloid LB Lv 1 1 pt. 6,642
  2. Avatar for larry25427 132. larry25427 Lv 1 1 pt. 6,200
  3. Avatar for Enzyme 133. Enzyme Lv 1 1 pt. 6,118
  4. Avatar for 01010011111 134. 01010011111 Lv 1 1 pt. 6,087
  5. Avatar for Unfunnee 135. Unfunnee Lv 1 1 pt. 5,915
  6. Avatar for Superintelligence 136. Superintelligence Lv 1 1 pt. 5,851
  7. Avatar for dm1111 137. dm1111 Lv 1 1 pt. 5,844
  8. Avatar for Snake bite 138. Snake bite Lv 1 1 pt. 5,803
  9. Avatar for smazumdar33 139. smazumdar33 Lv 1 1 pt. 5,410
  10. Avatar for altejoh 140. altejoh Lv 1 1 pt. 4,981

Comments