Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745

  1. Avatar for manu8170 31. manu8170 Lv 1 36 pts. 9,662
  2. Avatar for diamonddays 32. diamonddays Lv 1 35 pts. 9,636
  3. Avatar for smilingone 33. smilingone Lv 1 33 pts. 9,623
  4. Avatar for crpainter 34. crpainter Lv 1 32 pts. 9,620
  5. Avatar for pauldunn 35. pauldunn Lv 1 31 pts. 9,615
  6. Avatar for silent gene 36. silent gene Lv 1 30 pts. 9,586
  7. Avatar for gdnskye 37. gdnskye Lv 1 28 pts. 9,584
  8. Avatar for drumpeter18yrs9yrs 38. drumpeter18yrs9yrs Lv 1 27 pts. 9,580
  9. Avatar for robgee 39. robgee Lv 1 26 pts. 9,575
  10. Avatar for LavenderSky 40. LavenderSky Lv 1 25 pts. 9,565

Comments