Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for jausmh 51. jausmh Lv 1 16 pts. 9,424
  2. Avatar for pvc78 52. pvc78 Lv 1 15 pts. 9,401
  3. Avatar for johnmitch 53. johnmitch Lv 1 15 pts. 9,398
  4. Avatar for guineapig 54. guineapig Lv 1 14 pts. 9,394
  5. Avatar for Bautho 55. Bautho Lv 1 13 pts. 9,366
  6. Avatar for weitzen 56. weitzen Lv 1 13 pts. 9,299
  7. Avatar for YGK 57. YGK Lv 1 12 pts. 9,290
  8. Avatar for toshiue 58. toshiue Lv 1 12 pts. 9,287
  9. Avatar for alwen 59. alwen Lv 1 11 pts. 9,283
  10. Avatar for carsonfb 60. carsonfb Lv 1 11 pts. 9,250

Comments