Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622
  1. Avatar for Timo van der Laan 11. Timo van der Laan Lv 1 68 pts. 10,473
  2. Avatar for altejoh 12. altejoh Lv 1 65 pts. 10,414
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 63 pts. 10,362
  4. Avatar for robgee 14. robgee Lv 1 60 pts. 10,358
  5. Avatar for bertro 15. bertro Lv 1 58 pts. 10,356
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 55 pts. 10,332
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 53 pts. 10,288
  8. Avatar for guineapig 18. guineapig Lv 1 51 pts. 10,273
  9. Avatar for AtOneMent 19. AtOneMent Lv 1 49 pts. 10,263
  10. Avatar for eusair 20. eusair Lv 1 47 pts. 10,261

Comments