Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,800
  2. Avatar for Go Science 2. Go Science 70 pts. 10,793
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 10,733
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,592
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,533
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 10,473
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,288
  8. Avatar for Contenders 8. Contenders 4 pts. 10,237
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 2 pts. 10,101
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 9,622
  1. Avatar for Seagat2011 21. Seagat2011 Lv 1 45 pts. 10,248
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 43 pts. 10,244
  3. Avatar for crpainter 23. crpainter Lv 1 41 pts. 10,237
  4. Avatar for gdnskye 24. gdnskye Lv 1 39 pts. 10,223
  5. Avatar for nicobul 25. nicobul Lv 1 37 pts. 10,197
  6. Avatar for Blipperman 26. Blipperman Lv 1 36 pts. 10,188
  7. Avatar for Mike Cassidy 27. Mike Cassidy Lv 1 34 pts. 10,180
  8. Avatar for isaksson 28. isaksson Lv 1 33 pts. 10,158
  9. Avatar for joremen 29. joremen Lv 1 31 pts. 10,156
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 30 pts. 10,132

Comments