Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302

  1. Avatar for hexidecimalhack 101. hexidecimalhack Lv 1 1 pt. 9,834
  2. Avatar for fennec2000 102. fennec2000 Lv 1 1 pt. 9,815
  3. Avatar for gurch 103. gurch Lv 1 1 pt. 9,807
  4. Avatar for Anamfija 104. Anamfija Lv 1 1 pt. 9,791
  5. Avatar for Jesse Pinkman 105. Jesse Pinkman Lv 1 1 pt. 9,785
  6. Avatar for Knoblerine 106. Knoblerine Lv 1 1 pt. 9,780
  7. Avatar for NotJim99 107. NotJim99 Lv 1 1 pt. 9,714
  8. Avatar for parsnip 108. parsnip Lv 1 1 pt. 9,693
  9. Avatar for west.elsdon 109. west.elsdon Lv 1 1 pt. 9,691
  10. Avatar for klsl 110. klsl Lv 1 1 pt. 9,684

Comments