Placeholder image of a protein
Icon representing a puzzle

1535: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 18, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,862
  2. Avatar for Void Crushers 2. Void Crushers 74 pts. 10,857
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 10,802
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,790
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 10,751
  6. Avatar for Contenders 6. Contenders 18 pts. 10,719
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,693
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 10,642
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,627
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,302
  1. Avatar for JasperD 71. JasperD Lv 1 4 pts. 10,137
  2. Avatar for antibot215 72. antibot215 Lv 1 4 pts. 10,134
  3. Avatar for Deleted player 73. Deleted player pts. 10,124
  4. Avatar for altejoh 74. altejoh Lv 1 3 pts. 10,116
  5. Avatar for Superphosphate 75. Superphosphate Lv 1 3 pts. 10,115
  6. Avatar for Carrie_W 76. Carrie_W Lv 1 3 pts. 10,094
  7. Avatar for Merf 77. Merf Lv 1 3 pts. 10,066
  8. Avatar for AtOneMent 78. AtOneMent Lv 1 2 pts. 10,055
  9. Avatar for andrewxc 79. andrewxc Lv 1 2 pts. 10,045
  10. Avatar for drjr 80. drjr Lv 1 2 pts. 10,039

Comments