Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,771
  2. Avatar for Go Science 2. Go Science 63 pts. 10,670
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 10,657
  4. Avatar for Contenders 4. Contenders 21 pts. 10,653
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 10,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 10,535
  7. Avatar for HMT heritage 7. HMT heritage 2 pts. 10,505
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,450
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,361
  10. Avatar for Russian team 10. Russian team 1 pt. 10,003
  1. Avatar for Altercomp 91. Altercomp Lv 1 1 pt. 9,748
  2. Avatar for frostschutz 92. frostschutz Lv 1 1 pt. 9,692
  3. Avatar for guineapig 93. guineapig Lv 1 1 pt. 9,664
  4. Avatar for jamiexq 94. jamiexq Lv 1 1 pt. 9,664
  5. Avatar for toshiue 95. toshiue Lv 1 1 pt. 9,621
  6. Avatar for aznarog 96. aznarog Lv 1 1 pt. 9,597
  7. Avatar for cinnamonkitty 97. cinnamonkitty Lv 1 1 pt. 9,552
  8. Avatar for Mao Mao 98. Mao Mao Lv 1 1 pt. 9,550
  9. Avatar for MadCin 99. MadCin Lv 1 1 pt. 9,538
  10. Avatar for pielie 100. pielie Lv 1 1 pt. 9,521

Comments